PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B00515.1.p
Common NameEUGRSUZ_B00515, LOC104419830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 463aa    MW: 50053.6 Da    PI: 6.0245
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B00515.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1261.1e-39111171262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       ++k+++cprC+s++tkfCyynny+++qPr+fCkaC+ryWt+GG++rnvPvG+grrk+k+s 
  Eucgr.B00515.1.p 111 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKACQRYWTAGGTMRNVPVGAGRRKSKSSA 171
                       7899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.5E-32113169IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.593115169IPR003851Zinc finger, Dof-type
PROSITE patternPS013610117153IPR003851Zinc finger, Dof-type
ProDomPD0074787.0E-24119168IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MVEMTSDPAI RLFGKKIPLS YTGESPEASS GDGVVYSGVN SEEDDEGSEK CHSIEHFAME  60
VQEDDDQVSP ETVNPKTPSI EEESAKTKAS GIDQEQGDSS NSQEKPPLKK PDKIIPCPRC  120
NSMDTKFCYY NNYNVNQPRH FCKACQRYWT AGGTMRNVPV GAGRRKSKSS ASHYRQITLS  180
EALQAARIDA PNGTHLPNGK INGTVLTFGL DPSAGDSMAV ALNLSNKEGS AMNRMQNGFC  240
DFGRNGVSVP QRSGEKNDDC SSRSSVAISN LTDEGNGNSN LEGSSANGFH PQFPCYPGVP  300
QPYPWNPAML PPPFYPSGFA VPIYPAPLWN CGLHSSWNFP LLSPPSQKGS NSGPDSPTLG  360
KHAREGEMVE KVDSVEDEPR KRKNGCVLVP KTLRIDDPSE AAKSTIWATL GIKKDWLGKD  420
GLFQGFQSKG EEKNHVSETA SVLCANPAAL SRSIKFHESS CV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B00515.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029927.10.0PREDICTED: cyclic dof factor 3
TrEMBLA0A059D0750.0A0A059D075_EUCGR; Uncharacterized protein
STRINGGLYMA17G10920.31e-152(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54412848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-96cycling DOF factor 3